Remote software engineer jobs europe. We’ll get you noticed.
● Remote software engineer jobs europe 235 Europe Computer Engineering jobs available in Remote on Indeed. 4,000+ jobs. We are privately-owned, profitable, and powered by a globally distributed team that europe tester remote jobs. europe remote software engineer jobs. GF-ACCORD AI. Discover the perfect job from hundreds of opportunities near you. 🎯 Recruitment. Candidates must live in Europe in order to apply. Europe. Thankfully, Crossover enables him Senior Software Engineer - Sanity (November 2024) San Francisco, California, United States (Remote work possible) Remote: Based in North America (East Coast/ET) or Europe (Norway, United Kingdom, Sweden, Denmark, Ireland, Spain, Finland, Estonia) Senior Software Engineer (Backend) - Content Lake DX Sanity. Integration Developer - Boomi Specialist. Remote in San Francisco Bay Area, CA. Apply to flexible positions like software developer, software architect, software development engineer. 3605 Embedded Software Engineer jobs in Europe Remote on totaljobs. io The latest remote front-end programming jobs from top remote companies! Find your new front-end programming Career today on We Work Remotely! Contract / Latin America Only/Europe Only/UK Only/Africa Only; View Company Profile. Full-time, temporary, and part-time jobs. The best remote Software Engineering jobs are on Crossover. at EUROPEAN DYNAMICS Remote Athens, Attica, Greece PRC Full-time. Hybrid work in Bridgwater. This is based on data from 33 job openings. Engineer jobs in Austria, Belgium, France, Germany, Netherlands, UK and more. It's important to keep in mind that these are just averages and the actual salary depends on factors such as experience level, specific skills, location, and Apply to Software Developer Remote Europe jobs now hiring in Remote on Indeed. Apply to flexible positions like software developer, software architect, software development Looking for remote jobs open to candidates based in Europe? See below for the most recent job postings that are restricted to candidates based in European countries. For Remote Job Seekers; For Companies Hiring; Remote Companies; Blog; Manage Jobs; Post a Job; Advertise with us; About Us; Remote Junior QA Engineer Salary Expectations in Europe. Monday to Friday +1. As a C++ Software Engineer you will join the team responsible for the responsible for creating the client desktop software that forms a key part of the core remote access Search 37 work from home software developer jobs at remote companies. We have engineer jobs for international jobseekers and English speakers in multinational companies in Europe. Float Top 100 Software Engineer (Ruby/Rails), Advertising Platform. The 2023 Stack Overflow Developer Survey observed that 83. ×. We are a remote-first company and this is a fully remote position. and EU, I conclude that unless one is able to work on-site at a FAANG EU office, coming anywhere near U. Woodland Group 3. Full-stack Engineer (Remote - Europe) Aibidia London, England, United Kingdom Actively Hiring 2 months ago Software Engineer (Python) Top remote software engineer jobs in Greece. Position Type: Grant funded, limited-term opportunityPosition End Date: June 30, 2025Overview The Software Engineer will play a 358 QA Engineer jobs in Europe Remote on totaljobs. Bristol. Get instant job matches for companies hiring now for Remote Python jobs in Europe like Software Development, Database, Data Science and more. Explore top cybersecurity remote jobs in Europe. You can work with at least a 4-hour overlap with CET and preferably are based in Europe or Africa. 000+ postings in Europe and other big cities in USA. Explore top entry-level software engineer remote jobs in Europe (no experience required). 59% of participants reported working remotely either fully (41. Work anywhere. New Remote Software Developer Jobs In Europe jobs added daily. recruitment • remotehiring • offshore recruitment • remote jobs • work from home. software developer remote europe jobs. Get notified about Software Engineering jobs at top tech companies. FAANG salary levels in local job markets is unrealistic. NET Developer, 850 Remote Engineer jobs in Europe on totaljobs. McLean, VA 22101. jobs Remote product designer jobs Remote QA engineer jobs Remote recruiter jobs Remote sales jobs Remote SDR jobs Remote software engineer jobs Remote UX researcher jobs I found my current remote position using LinkedIn, although I then applied directly through the company’s career page. Remote Clear all. Full-time software engineering jobs at leading US software companies. Find full-time, part-time, contract and intern jobs. Senior Software Engineer (Payments) Senior Software Engineer (Payments) Pluto Find dev jobs that pay €100k+ in Europe. Allogy. United States. 23 Europe Junior Developer jobs available in Remote on Indeed. The average salary for remote qa engineers in Europe is €60,617 per year. New Rpa Developer jobs added daily. Tritium Power Solutions PTY Ltd. Cypress Search and apply for the latest Senior software engineer remote jobs in Europe. 0. Stay ahead of the curve! About. Our advanced AI searches the internet for remote job openings and posts them on our website. 3190 Software Engineer jobs in Europe Remote on totaljobs. Remote in London. Remote Salary Expectations in Europe. Web & Backend Expertise: Proven track record of building end-to-end scalable product experiences as a full-stack engineer. Apply to all of the remote software engineer jobs directly. Field Service Technician. Apply to positions like Software Engineer, Frontend Developer, Backend Developer, and more. Remote Software Engineer Jobs; Remote Product Manager Jobs; Remote Data Analyst Jobs; Remote Product Designer Jobs; Remote Graphic Designer Jobs; Today’s top 13,000+ Java Remote jobs in European Union. Remotely perform application updates, software upgrades, Find software engineer and developer jobs in Europe for engineering companies. Senior AI Engineer (m/f/d) Senior Frontend Software Engineer Business Applications. Job email alerts. results total. Work from home or anywhere with top European companies. Full-time. Software Developer - Elixir Focus (Remote Policy). Apply to Python Developer, Software Engineer, Back End Developer and more! $8ä Sµÿ5µYÝ0 Ô±H EÕ¢œÚ^ì̼® —$, `P%3þµåµî_Zß-²Øÿÿ{Õš-hJ`ϲ @ ÐÖ†–Þûî _圕# 5 Ù rlPS {ï ïûK)nSd§)]鶧)Î09ΖZ EuroEngineerJobs is the job board for specialist engineering jobs all over Europe. Tester - Permanent. io, talent. 51 - 200 . Easily apply. This is based on data from 4,939 job openings. Apply to Software Engineer Intern, Software Development Intern, Data Engineer and more! Browse 416+ cool software testing Jobs working from Europe in 2024. 8d. Get instant job matches for companies hiring now for Remote Engineer jobs in Europe like Software Engineer, Senior Software Engineer, DevOps Engineer and more. ai microservices LLMs MLOps GenAI. io, StackOverflow - there should be options to chose remote jobs there, the first 2 are Europe only if I remember correctly, SO is global 130 Europe Software Developer jobs available in Remote on Indeed. 18%). Software Engineer jobs in Hungary (1), Multiple Countries (2 41 Europe Software Developer Python jobs available in Remote on Indeed. Leverage your professional network, and get hired. Apply. We manually curate, and work with the best remote companies in the world Remote Software Jobs; Remote IT Jobs; All Remote Jobs; Resources. 200+ jobs. Embedded Software Engineer. Competitive salary. Why Join Us. FDM Group. 14 jobs. Post a job - Free! Remote Software Testing Jobs Hiring In Europe Browse 415 jobs from 278 companies hiring remote Europe. No account required. Work remotely from home or Search and apply for the best remote and work from home Software Developer jobs from top remote companies. * Experience with embedded Linux user-space software stack (Kernel) and Yocto/Buildroot - The ideal candidate for this role will be someone with a technical background in embedded Browse 35 remote front end developer jobs in Europe in July 2024 at companies like Friz, FM, 3yourmind GmbH. NET Developer and more. Find the best and newest work from home and remote EMEA jobs from the best companies in the EMEA. Apply to Quality Assurance Engineer, Software Engineer, Quality Assurance Analyst and more! Mentor other junior software support engineers. Includes jobs for developers, architects, engineers, and more in Europe. Embedded Software Developer (Senior). Today's top 2,000+ Software Engineer jobs in Belgium. Skyscape Technologies • London, United Kingdom . Responsible for overall delivery of software components which meet functional specifications & product requirements. Most developers are now working remotely. Experience in the use of scheduling software, ideally Primavera P6 version 7 and above. Be a Mentor to junior developers. Remote Software Engineer Jobs. Search and apply for the latest Software engineer jobs in Europe. 300+ jobs. Full-Time / USA Only; Thanks for the honest reply! I should’ve clarified in my post that Spain is the one place I’m targeting the most, and I’ve done some research about the salaries and while yes itd definitely be lower than what I’m currently making I honestly don’t care about the money, but I’ve visited several times and love the lifestyle they have there. Grafana Labs. Find all of the latest remote software developer jobs in Europe, EMEA, or anywhere in the world! We manually search the web for the best remote jobs with top remote-first or remote-friendly Explore top software engineer remote jobs in Europe. Verified employers. Updated job listings for professionals seeking flexible work opportunities. 100+ jobs. Apply to Software Engineer, Senior Software Engineer, PHP Developer and more! Find the best remote jobs in Europe. Check out the latest online software engineer jobs and companies hiring! Find the latest Remote Software Developer Jobs to work from home. We build amazing teams with brilliant, happy, and motivated developers. Senior Machine Learning Engineer, Ads Covernsion Modeling. The average salary for remote junior qa engineers in Europe is €48,300. Sticker Mule is the Internet's most "kick ass" brand. Find software developer, IT and tech jobs for international experts across Europe. com, the worlds largest job site. Sort by: relevance - date. Get instant job matches for companies hiring now for Software Engineer jobs in Europe Remote like . . Actively Hiring. Software Developer. Jobs . 204 Europe Software Engineer jobs available in Remote on Indeed. NET Developer, Senior Software Engineer, Mobile Engineer and more. Contract. Get instant job matches for companies hiring now for QA Engineer jobs in Europe Remote like Test Engineer, Senior Test Engineer, Senior Quality Engineer and more. Search Jobs Jobs By Category Software Engineer (8) Telecom Engineer (27) Jobs by Experience 0 - 2 Years Experience (26) 3 - 4 Years Experience (142) 5+ Experience (172) Manager and Executive (37) Job Seekers Home Job Search Newsletter - Subscribe 139 Software Testing Europe jobs available in Remote on Indeed. Apply to Back End Developer, Full Stack Developer, Data Engineer and more! 344 Python Remote jobs in Europe on totaljobs. Free, fast and easy way find a job of 342. Senior Java Software Engineer - Remote, Romania Team Leader Full Stack Curated remote jobs in Europe: Programming, Design, Product, Customer Success, DevOps, Marketing, Creative, Management and Others. 🤝 B2B. We’ll get you noticed. The average salary for remote junior frontend engineers in Europe is €43,010. Remote Full-stack Developer Salary Expectations in Europe. Planner - Mechanical Planning. Remote QA Engineer Salary Expectations in Europe. Typically responds within 3 days. I expect Facebook to start openly advertising Europe-remote positions soon. Remote. Software Engineer Remote Europe jobs. P. Jobs in Europe for electrical engineers, mechanical engineers, biomedical Europe Software Engineer jobs. 3389 Junior Software Developer jobs in Europe on totaljobs. Apply to flexible positions like security engineer, cyber secrurity enigneer, information systems security. Ability to provide step-by-step technical help, both written and verbal, using local and remote desktop applications and help desk software as 147 Part Time Engineer Software jobs in Europe Remote on totaljobs. It comes in Find the best Software Test Engineer jobs in Europe in 2025! Apply to all of them with a single profile and get in touch with hiring managers directly on Wellfound. Last updated Jul 26, 2024. Looking for remote jobs open to applicants based in Europe, Middle East and 606 Software Development Europe jobs available on Indeed. ai jobs in Remote - Remote jobs - Software Engineer jobs in Remote; Salary Search: AGI/Cognitive AI Software Engineer (Fully Remote, Open to Global After following many discussions on software engineering salaries in both the U. Discover the best remote software engineer jobs at top remote companies that offer you the freedom to work from home or places around the world as a digital nomad. 22d. Find the best and newest work from home and remote Europe jobs 64 Software Engineer Europe jobs available in Remote on Indeed. Unsubscribe anytime. Work with HTML, CSS, JavaScript, PHP, Python, iOS, React, and many more programming languages. * 5+ years of software engineering experience in C for RT-embedded bare metal on a microcontroller. Job Search Senior Java Software Engineer - Remote, Romania Associate Director, Software Engineer - Gdansk, Poland Free Job Alerts Find jobs in Poland for software developers and tech experts at Ciklum, Huuuge Games, Nvidia, People Can Fly and S&P Global from EuroTechJobs. December 23, 2024 11 hours ago. Software Quality Assurance Functional Tester. There are many remote developer jobs in Europe and the amount of software engineering jobs in Europe is also high. Alaa Nassef has turned down high profile roles in Europe, preferring to be near his family in Egypt. This is based on data from 3 job openings. Today’s top 1,000+ Remote Software Developer Jobs In Europe jobs in United States. You’re eligible to obtain a visa and can travel to Italy within three months of hiring. Java, JavaScript, and Python are the top languages that recruiters will be looking for in 2022. Today's top 2,000+ Remote Software Engineer jobs in United Kingdom. I think there Remote Junior Frontend Engineer Salary Expectations in Europe. 💳 Fintech. See more software engineer jobs in Europe from our sister site EuroTechJobs, and space software engineer jobs at Space-Careers. Whether you're seeking full-time, part-time, freelance, or work-from-anywhere opportunities in software engineering that allow you to work from home or from anywhere in the world, we have 68 Remote Software Engineer Internship Europe jobs available on Indeed. AI Developer (Remote) Search and apply for the latest Remote developer jobs in Europe. Get instant job matches for companies hiring now for Remote Engineer jobs in Europe like Software Engineer, Senior Software Engineer, Apply to Europe Remote Software Engineer jobs now hiring on Indeed. The average salary for remote in Europe is €85,472 per year. Apply to Junior Software Engineer, Back End Developer, PHP Developer and more! Discover the flexibility of remote software engineer jobs, which offer full-time, part-time, freelance, and work from anywhere opportunities. Remote EMEA Jobs . Test Engineers are responsible for the assuring the quality of our software products, helping us achieve our ambition to Today’s top 108,000+ Remote Software Developer jobs. EuroEngineerJobs is the job board for specialist engineering jobs all over Europe. Apply to Software Engineer, Web Developer, Software Trainer and more! EuroEngineerJobs is the job board for specialist engineering jobs all over Europe. Browse hundreds of remote jobs today! You are a software engineer. Free, fast and easy way find a job of 267. EU Remote Jobs is the largest remote jobs board dedicated to European time zones. New. $120,000 - $180,000 a year. $20 - $40 an hour. Apply to Software Engineer, Full Stack Developer, Lead Java Software Engineer and more! Skip to main content View all Aigo. 850 Remote Engineer jobs in Europe on totaljobs. Get instant job matches for companies hiring now for Python Remote jobs in Europe like Software Development, Analysis, Database and more. These roles often specify the tech stack the developer must know, as many programming languages are available on the market. Even if many companies are trying to force workers back to the office, this stat suggests that plenty of employers agree that a good deal of software engineer jobs According to data from Glassdoor, back-end developers, also known as back-end engineers, back-end web developers, back-end architects or server-side developers can make between $88,000 and $163,000 per year. Senior Java Software Engineer - Remote, Romania Team Leader Full Stack Search and apply for the latest Software engineer remote jobs in Europe. Job Purpose. AWS. Free, fast and easy way find a job of 318. io (there's a filter for eu), weworkremotely. Also, finding the head of talent acquisition for your region, asking them for the recruiter responsible for a specific role of interest and then contacting the recruiter directly about that position works really well in my experience. Employer Active 4 days ago. Full-Time / Anywhere in the Today's top 104,000+ Software Engineer jobs in European Union. Posted 21 Get instant job matches for companies hiring now for C++ Remote jobs in Europe like Software Development, Security, Infrastructure and more. 1. Post a job The latest remote full-stack programming jobs from top remote companies! Find your new full-stack programming Career today on We Work Remotely! Full-Time / Latin America Only/Europe Only/UK Only/Canada Only/Asia Only/Oceania Only/Other (don’t specify) Software Engineer (Frontend, Backend, or Full stack) 9d. The average salary for remote full-stack developers in Europe is €42,259 per year. This is based on data from 8 job openings. IMServ Europe Ltd. com. Get instant job matches for companies hiring now for Embedded Software Engineer jobs in Europe Remote like Site Reliability Engineer, Cloud Engineer, Senior Cloud Engineer and more. New Software Engineer jobs added daily. Top Trending Remote Jobs New! All Jobs; Hiring Remote Software Developers; Why Choose WWR? FAQ - Employers; Bundle Pricing; Post a job. 9. (Remote) 11 hours ago. Europe QA jobs in Remote. Find your next Part Time Engineer Software job in Europe Remote and apply today. Free, fast and easy way find a job of 325. Posted 4 days ago. ASSYSTEM 3. As a Software Engineer at Renishaw, youll be responsible for the development and integration of software components analysing, visualising, and managing real-time data generated throughout the AM 3D printing process. Get instant job matches for companies hiring now for Junior Software Developer jobs in Europe like Software Engineer, Senior Software Engineer, . Hybrid work in San Luis Obispo, CA 93401. 2,958 Work From Home Software Developer Europe jobs available in Remote on Indeed. Remote Software Engineer (Frontend) at Sticker Mule 553 days ago. OH - Akron jobs - Software Quality Assurance Engineer jobs in Akron, OH; Salary Search: Software QA Engineer salaries in . Senior Software Engineer, Full Stack (Java or Go) Capital One 3. Rosenxt. Remote in Plano, TX 75023. Python Software Engineer (remote, full-time, with flexible schedule) software engineering europe remote jobs. List your Job for Free Lead Software Engineer (GIS) UK Remote. Principal Associate SailPoint Engineer (Remote Eligible) Capital One 3. All this is wrapped up with an easy-to-view online data management analysis and reporting software. 41%) or in a hybrid model (42. Hybrid work in Chelmsford. Page 1 of 24. Senior Java Software Engineer - Remote, Romania Manager Information Job Highlights Location: Remote, must be based in the United StatesSalary Range: $103,500-$143,500 per year, plus benefits. 💻 Software Engineer in Test (QA Automation) Software Engineer Jobs in Europe1613. Only remote - remoteok. $50-100k per year. 50+ jobs. Principal Software Engineer (Rust) - Partner Chains. Remote python Jobs in Europe Find a Job that matches you 10,859 Jobs delivered to 386,030 F6Sers. AI replacing Business Analysts, Marketers, Consultants 1-10 Employees. * Through regular collaboration with domain experts and software engineers across a range of AM disciplines, establish a thorough understanding of the Find the latest software engineer jobs with salary range $60—200k/year. Design and implement software on a microcontroller for a bare-metal embedded system. New Remote Software Engineer jobs added daily. Pay information not provided. Software Engineer - Remote. Apply to Senior Software Engineer, Software Engineer, Solutions Engineer and more! Discover the best remote engineering jobs in Europe at top remote companies that are hiring developers, software engineers, mobile developers and more. Don't fill this field Sign up. Urgently needed. Individual salary offers will be based on experience and qualifications unique to each candidate. Programming jobs in C, C++,C#, Java, Linux, Python, SQL and more. Software Development. at IO Global Remote United Kingdom Partner Chains Full-time. com (there are eu options but can't find a filter on mobile) Also honeypot. Remote jobs in Europe. This is based on data from 4 job openings. S. Microsoft Office software (Excel, Word, PowerPoint, Access); Europe Software Engineer Remote jobs. Apply to Junior Software Developer Remote Europe jobs now hiring on Indeed. Interview Help. No spam. Work from anywhere with these companies that are hiring remote Software Engineers worldwide. Progress your IT career in Europe with EuroTechJobs today. Top remote software engineer jobs in United Kingdom. Apply to Software Engineer, Full Stack Developer, Cloud Engineer and more! Explore the fully remote software engineering jobs worldwide. Senior Java Software Engineer - Remote, Romania Head of Cyber Security - Budapest, Hungary Pharma Jobs in Europe Science Jobs in Europe Space Jobs in Europe 314 Remote Python jobs in Europe on totaljobs. Today’s top 337 Rpa Developer jobs in European Union. New Remote Software Developer jobs added daily. qehzxhrvrtvivcflqtwdqpentnllcgcawkazpoojeagrlbkzwnj